Anti-IL1RL1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-IL1RL1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA007406
• Supplier Catalog Number: HPA007406
• Alternative Catalog Number: ATA-HPA007406-100,ATA-HPA007406-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: DER4, FIT-1, IL33R, ST2, ST2L, ST2V, T1

Product Description

interleukin 1 receptor-like 1

Additional Information

Anti-IL1RL1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 9173
• UniProt: Q01638
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: PDVLENKCGYTLCIYGRDMLPGEDVVTAVETNIRKSRRHIFILTPQITHNKEFAYEQEVALHCALIQNDAKVILIEMEALSELDMLQAEALQDSLQHLMKVQGTIKWREDHIANKRSLNSKFWKHVRYQMPVPSKIPRKASSLTPL
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: IL1RL1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml

Images

Immunohistochemical staining of human kidney shows moderate membranous positivity in cells in glomeruli.

Immunohistochemical staining of human placenta shows moderate membranous positivity in trophoblastic cells.

Immunohistochemical staining of human stomach shows moderate membranous positivity in glandular cells.

Immunohistochemical staining of human lung shows moderate membranous positivity in pneumocytes.

Western blot analysis in human cell line HEL.

HPA007406

HPA007406

HPA007406