Anti-IL1RL1

Catalog Number: ATA-HPA007406
Article Name: Anti-IL1RL1
Biozol Catalog Number: ATA-HPA007406
Supplier Catalog Number: HPA007406
Alternative Catalog Number: ATA-HPA007406-100,ATA-HPA007406-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DER4, FIT-1, IL33R, ST2, ST2L, ST2V, T1
interleukin 1 receptor-like 1
Anti-IL1RL1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 9173
UniProt: Q01638
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PDVLENKCGYTLCIYGRDMLPGEDVVTAVETNIRKSRRHIFILTPQITHNKEFAYEQEVALHCALIQNDAKVILIEMEALSELDMLQAEALQDSLQHLMKVQGTIKWREDHIANKRSLNSKFWKHVRYQMPVPSKIPRKASSLTPL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: IL1RL1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human kidney shows moderate membranous positivity in cells in glomeruli.
Immunohistochemical staining of human placenta shows moderate membranous positivity in trophoblastic cells.
Immunohistochemical staining of human stomach shows moderate membranous positivity in glandular cells.
Immunohistochemical staining of human lung shows moderate membranous positivity in pneumocytes.
Western blot analysis in human cell line HEL.
HPA007406-100ul
HPA007406-100ul
HPA007406-100ul