Anti-IP6K2
Artikelnummer:
ATA-HPA007532
- Bilder (7)
| Artikelname: | Anti-IP6K2 |
| Artikelnummer: | ATA-HPA007532 |
| Hersteller Artikelnummer: | HPA007532 |
| Alternativnummer: | ATA-HPA007532-100,ATA-HPA007532-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | IHPK2 |
| inositol hexakisphosphate kinase 2 |
| Anti-IP6K2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 51447 |
| UniProt: | Q9UHH9 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | IP6K2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human stomach shows strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows moderate nuclear positivity in cells in glomeruli. |
|
|
Immunohistochemical staining of human skin shows moderate to strong nuclear positivity in keratinocytes. |
|
|
Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells. |
|
|
HPA007532-100ul |
|
|
HPA007532-100ul |
|
|
HPA007532-100ul |
Produktgarantie und fachkundiger Support
