Anti-IP6K2
Catalog Number:
ATA-HPA007532
- Images (7)
| Article Name: | Anti-IP6K2 |
| Biozol Catalog Number: | ATA-HPA007532 |
| Supplier Catalog Number: | HPA007532 |
| Alternative Catalog Number: | ATA-HPA007532-100,ATA-HPA007532-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | IHPK2 |
| inositol hexakisphosphate kinase 2 |
| Anti-IP6K2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 51447 |
| UniProt: | Q9UHH9 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | IP6K2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human stomach shows strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows moderate nuclear positivity in cells in glomeruli. |
|
|
Immunohistochemical staining of human skin shows moderate to strong nuclear positivity in keratinocytes. |
|
|
Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells. |
|
|
HPA007532-100ul |
|
|
HPA007532-100ul |
|
|
HPA007532-100ul |
Product Guarantee and Expert Support
