Anti-COL3A1

Artikelnummer: ATA-HPA007583
Artikelname: Anti-COL3A1
Artikelnummer: ATA-HPA007583
Hersteller Artikelnummer: HPA007583
Alternativnummer: ATA-HPA007583-100,ATA-HPA007583-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: EDS4A
collagen, type III, alpha 1
Anti-COL3A1
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 1281
UniProt: P02461
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: COL3A1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human endometrium shows weak to moderate cytoplasmic positivity in stromal cells.
Immunohistochemical staining of human skin shows weak to moderate cytoplasmic positivity in fibroblasts.
Immunohistochemical staining of human colorectal cancer shows weak to moderate cytoplasmic positivity in stromal cells.
Immunohistochemical staining of human pancreas shows very weak positivity in exocrine glandular cells as expected.
Western blot analysis in human cell lines HeLa and SK-MEL-30 using Anti-COL3A1 antibody. Corresponding COL3A1 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
HPA007583-100ul
HPA007583-100ul
HPA007583-100ul