Anti-COL3A1 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA007583
Article Name: Anti-COL3A1 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA007583
Supplier Catalog Number: HPA007583
Alternative Catalog Number: ATA-HPA007583-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: EDS4A
collagen, type III, alpha 1
Anti-COL3A1
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 1281
UniProt: P02461
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: COL3A1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human endometrium shows weak to moderate cytoplasmic positivity in stromal cells.
Immunohistochemical staining of human skin shows weak to moderate cytoplasmic positivity in fibroblasts.
Immunohistochemical staining of human colorectal cancer shows weak to moderate cytoplasmic positivity in stromal cells.
Immunohistochemical staining of human pancreas shows very weak positivity in exocrine glandular cells as expected.
Western blot analysis in human cell lines HeLa and SK-MEL-30 using Anti-COL3A1 antibody. Corresponding COL3A1 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
HPA007583
HPA007583
HPA007583