Anti-MAP1LC3A Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA007649
Artikelname: Anti-MAP1LC3A Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA007649
Hersteller Artikelnummer: HPA007649
Alternativnummer: ATA-HPA007649-100,ATA-HPA007649-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ATG8E, LC3, LC3A, MAP1ALC3, MAP1BLC3
microtubule-associated protein 1 light chain 3 alpha
Anti-MAP1LC3A
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 84557
UniProt: Q9H492
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MAP1LC3A
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-MAP1LC3A antibody. Corresponding MAP1LC3A RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Western blot analysis in human cerebral cortex tissue.
Western blot analysis in control (vector only transfected HEK293T lysate) and MAP1LC3A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403169).
HPA007649
HPA007649
HPA007649