Anti-MAP1LC3A Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA007649
Article Name: Anti-MAP1LC3A Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA007649
Supplier Catalog Number: HPA007649
Alternative Catalog Number: ATA-HPA007649-100,ATA-HPA007649-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ATG8E, LC3, LC3A, MAP1ALC3, MAP1BLC3
microtubule-associated protein 1 light chain 3 alpha
Anti-MAP1LC3A
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 84557
UniProt: Q9H492
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: MAP1LC3A
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-MAP1LC3A antibody. Corresponding MAP1LC3A RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Western blot analysis in human cerebral cortex tissue.
Western blot analysis in control (vector only transfected HEK293T lysate) and MAP1LC3A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403169).
HPA007649
HPA007649
HPA007649