Anti-MST1R
Artikelnummer:
ATA-HPA007657
- Bilder (8)
| Artikelname: | Anti-MST1R |
| Artikelnummer: | ATA-HPA007657 |
| Hersteller Artikelnummer: | HPA007657 |
| Alternativnummer: | ATA-HPA007657-100,ATA-HPA007657-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CD136, CDw136, PTK8, RON |
| macrophage stimulating 1 receptor (c-met-related tyrosine kinase) |
| Anti-MST1R |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 4486 |
| UniProt: | Q04912 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SATEPELGDYRELVLDCRFAPKRRRRGAPEGGQPYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVFVTGKDGGPGVGPNSVVCAFPIDLLDTLIDEGVERCCESPVHPGLRRGLDFFQSPSFCPNPPGLEALSPNTSCRHFPLLVSSSF |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MST1R |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human cerebral cortex, colon, lymph node and skin using Anti-MST1R antibody HPA007657 (A) shows similar protein distribution across tissues to independent antibody HPA008180 (B). |
|
|
Immunohistochemical staining of human skin using Anti-MST1R antibody HPA007657. |
|
|
Immunohistochemical staining of human colon using Anti-MST1R antibody HPA007657. |
|
|
Immunohistochemical staining of human lymph node using Anti-MST1R antibody HPA007657. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-MST1R antibody HPA007657. |
|
|
HPA007657-100ul |
|
|
HPA007657-100ul |
|
|
HPA007657-100ul |
Produktgarantie und fachkundiger Support
