Anti-MST1R
Catalog Number:
ATA-HPA007657
- Images (8)
| Article Name: | Anti-MST1R |
| Biozol Catalog Number: | ATA-HPA007657 |
| Supplier Catalog Number: | HPA007657 |
| Alternative Catalog Number: | ATA-HPA007657-100,ATA-HPA007657-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CD136, CDw136, PTK8, RON |
| macrophage stimulating 1 receptor (c-met-related tyrosine kinase) |
| Anti-MST1R |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 4486 |
| UniProt: | Q04912 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SATEPELGDYRELVLDCRFAPKRRRRGAPEGGQPYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVFVTGKDGGPGVGPNSVVCAFPIDLLDTLIDEGVERCCESPVHPGLRRGLDFFQSPSFCPNPPGLEALSPNTSCRHFPLLVSSSF |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MST1R |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human cerebral cortex, colon, lymph node and skin using Anti-MST1R antibody HPA007657 (A) shows similar protein distribution across tissues to independent antibody HPA008180 (B). |
|
|
Immunohistochemical staining of human skin using Anti-MST1R antibody HPA007657. |
|
|
Immunohistochemical staining of human colon using Anti-MST1R antibody HPA007657. |
|
|
Immunohistochemical staining of human lymph node using Anti-MST1R antibody HPA007657. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-MST1R antibody HPA007657. |
|
|
HPA007657-100ul |
|
|
HPA007657-100ul |
|
|
HPA007657-100ul |
Product Guarantee and Expert Support
