Anti-MRPS22
Artikelnummer:
ATA-HPA007830
- Bilder (8)
| Artikelname: | Anti-MRPS22 |
| Artikelnummer: | ATA-HPA007830 |
| Hersteller Artikelnummer: | HPA007830 |
| Alternativnummer: | ATA-HPA007830-100,ATA-HPA007830-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C3orf5, GIBT, GK002, MRP-S22 |
| mitochondrial ribosomal protein S22 |
| Anti-MRPS22 |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 56945 |
| UniProt: | P82650 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RMIQVYFPKEGRKILTPIIFKEENLRTMYSQDRHVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYDLLRSTRYFGGMVWYFVNNKKIDGLLIDQIQRDLIDDATNLVQLYHVLHPDGQSAQGAKD |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MRPS22 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human cerebral cortex, colon, kidney and testis using Anti-MRPS22 antibody HPA007830 (A) shows similar protein distribution across tissues to independent antibody HPA006083 (B). |
|
|
Immunohistochemical staining of human kidney using Anti-MRPS22 antibody HPA007830. |
|
|
Immunohistochemical staining of human colon using Anti-MRPS22 antibody HPA007830. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-MRPS22 antibody HPA007830. |
|
|
Immunohistochemical staining of human testis using Anti-MRPS22 antibody HPA007830. |
|
|
HPA007830-100ul |
|
|
HPA007830-100ul |
|
|
HPA007830-100ul |
Produktgarantie und fachkundiger Support
