Anti-MRPS22
Catalog Number:
ATA-HPA007830
- Images (8)
| Article Name: | Anti-MRPS22 |
| Biozol Catalog Number: | ATA-HPA007830 |
| Supplier Catalog Number: | HPA007830 |
| Alternative Catalog Number: | ATA-HPA007830-100,ATA-HPA007830-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C3orf5, GIBT, GK002, MRP-S22 |
| mitochondrial ribosomal protein S22 |
| Anti-MRPS22 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 56945 |
| UniProt: | P82650 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RMIQVYFPKEGRKILTPIIFKEENLRTMYSQDRHVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYDLLRSTRYFGGMVWYFVNNKKIDGLLIDQIQRDLIDDATNLVQLYHVLHPDGQSAQGAKD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MRPS22 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human cerebral cortex, colon, kidney and testis using Anti-MRPS22 antibody HPA007830 (A) shows similar protein distribution across tissues to independent antibody HPA006083 (B). |
|
|
Immunohistochemical staining of human kidney using Anti-MRPS22 antibody HPA007830. |
|
|
Immunohistochemical staining of human colon using Anti-MRPS22 antibody HPA007830. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-MRPS22 antibody HPA007830. |
|
|
Immunohistochemical staining of human testis using Anti-MRPS22 antibody HPA007830. |
|
|
HPA007830-100ul |
|
|
HPA007830-100ul |
|
|
HPA007830-100ul |
Product Guarantee and Expert Support
