Anti-IL1RL1

Artikelnummer: ATA-HPA007917
Artikelname: Anti-IL1RL1
Artikelnummer: ATA-HPA007917
Hersteller Artikelnummer: HPA007917
Alternativnummer: ATA-HPA007917-100,ATA-HPA007917-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DER4, FIT-1, IL33R, ST2, ST2L, ST2V, T1
interleukin 1 receptor-like 1
Anti-IL1RL1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 9173
UniProt: Q01638
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRY
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: IL1RL1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50
Immunofluorescent staining of human cell line HaCaT shows localization to vesicles.
Immunohistochemical staining of human placenta shows weak to moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemical staining of human prostate shows weak to moderate cytoplasmic positivity in cells in tubules.
Immunohistochemical staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.
HPA007917-100ul
HPA007917-100ul
HPA007917-100ul