Anti-IL1RL1 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA007917
Article Name: Anti-IL1RL1 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA007917
Supplier Catalog Number: HPA007917
Alternative Catalog Number: ATA-HPA007917-100,ATA-HPA007917-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DER4, FIT-1, IL33R, ST2, ST2L, ST2V, T1
interleukin 1 receptor-like 1
Anti-IL1RL1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 9173
UniProt: Q01638
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRY
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: IL1RL1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50
Immunofluorescent staining of human cell line HaCaT shows localization to vesicles.
Immunohistochemical staining of human placenta shows weak to moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemical staining of human prostate shows weak to moderate cytoplasmic positivity in cells in tubules.
Immunohistochemical staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.
HPA007917
HPA007917
HPA007917