Anti-CDK7 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA007932
Artikelname: Anti-CDK7 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA007932
Hersteller Artikelnummer: HPA007932
Alternativnummer: ATA-HPA007932-100,ATA-HPA007932-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CAK, CAK1, CDKN7, MO15, STK1
cyclin-dependent kinase 7
Anti-CDK7
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 1022
UniProt: P50613
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLI
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CDK7
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human gallbladder and liver tissues using Anti-CDK7 antibody. Corresponding CDK7 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human gallbladder shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
Western blot analysis in human cell lines Caco-2 and MCF-7 using Anti-CDK7 antibody. Corresponding CDK7 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Western blot analysis in control (vector only transfected HEK293T lysate) and CDK7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419742).
HPA007932
HPA007932
HPA007932