Anti-CDK7

Catalog Number: ATA-HPA007932
Article Name: Anti-CDK7
Biozol Catalog Number: ATA-HPA007932
Supplier Catalog Number: HPA007932
Alternative Catalog Number: ATA-HPA007932-100,ATA-HPA007932-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CAK, CAK1, CDKN7, MO15, STK1
cyclin-dependent kinase 7
Anti-CDK7
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 1022
UniProt: P50613
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLI
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CDK7
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human gallbladder and liver tissues using Anti-CDK7 antibody. Corresponding CDK7 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human gallbladder shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
Western blot analysis in human cell lines Caco-2 and MCF-7 using Anti-CDK7 antibody. Corresponding CDK7 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Western blot analysis in control (vector only transfected HEK293T lysate) and CDK7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419742).
HPA007932-100ul
HPA007932-100ul
HPA007932-100ul