Anti-VSIR

Artikelnummer: ATA-HPA007968
Artikelname: Anti-VSIR
Artikelnummer: ATA-HPA007968
Hersteller Artikelnummer: HPA007968
Alternativnummer: ATA-HPA007968-100,ATA-HPA007968-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: B7-H5, B7H5, C10orf54, GI24, PD-1H, SISP1, VISTA
V-set immunoregulatory receptor
Anti-VSIR
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 64115
UniProt: Q9H7M9
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: VSIR
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human tonsil shows moderate to strong cytoplasmic positivity in a subset of lymphoid cells.
Immunohistochemical staining of human fallopian tube shows strong cytoplasmic positivity in leukocytes.
Immunohistochemical staining of human liver shows strong cytoplasmic positivity in leukocytes.
Western blot analysis in human cell lines A-431 and HEK293 using Anti-VSIR antibody. Corresponding VSIR RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Western blot analysis in control (vector only transfected HEK293T lysate) and C10orf54 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411741).
HPA007968-100ul
HPA007968-100ul
HPA007968-100ul