Anti-VSIR Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA007968
Article Name: Anti-VSIR Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA007968
Supplier Catalog Number: HPA007968
Alternative Catalog Number: ATA-HPA007968-100,ATA-HPA007968-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: B7-H5, B7H5, C10orf54, GI24, PD-1H, SISP1, VISTA
V-set immunoregulatory receptor
Anti-VSIR
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 64115
UniProt: Q9H7M9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: VSIR
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human tonsil shows moderate to strong cytoplasmic positivity in a subset of lymphoid cells.
Immunohistochemical staining of human fallopian tube shows strong cytoplasmic positivity in leukocytes.
Immunohistochemical staining of human liver shows strong cytoplasmic positivity in leukocytes.
Western blot analysis in human cell lines A-431 and HEK293 using Anti-VSIR antibody. Corresponding VSIR RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Western blot analysis in control (vector only transfected HEK293T lysate) and C10orf54 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411741).
HPA007968
HPA007968
HPA007968