Anti-CEL

Artikelnummer: ATA-HPA008023
Artikelname: Anti-CEL
Artikelnummer: ATA-HPA008023
Hersteller Artikelnummer: HPA008023
Alternativnummer: ATA-HPA008023-100,ATA-HPA008023-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: BSSL, MODY8
carboxyl ester lipase
Anti-CEL
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 1056
UniProt: None
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: HWEPYTTENSGYLEITKKMGSSSMKRSLRTNFLRYWTLTYLALPTVTDQEATPVPPTGDSEATPVPPTGDSG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CEL
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human pancreas and liver tissues using Anti-CEL antibody. Corresponding CEL RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human breast, cerebral cortex, liver and pancreas using Anti-CEL antibody HPA008023 (A) shows similar protein distribution across tissues to independent antibody HPA052701 (B).
Immunohistochemical staining of human pancreas shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
Immunohistochemical staining of human cerebral cortex using Anti-CEL antibody HPA008023.
Immunohistochemical staining of human breast using Anti-CEL antibody HPA008023.
HPA008023-100ul
HPA008023-100ul
HPA008023-100ul