Anti-CEL Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA008023
Article Name: Anti-CEL Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA008023
Supplier Catalog Number: HPA008023
Alternative Catalog Number: ATA-HPA008023-100,ATA-HPA008023-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: BSSL, MODY8
carboxyl ester lipase
Anti-CEL
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 1056
UniProt: None
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: HWEPYTTENSGYLEITKKMGSSSMKRSLRTNFLRYWTLTYLALPTVTDQEATPVPPTGDSEATPVPPTGDSG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CEL
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human pancreas and liver tissues using Anti-CEL antibody. Corresponding CEL RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human breast, cerebral cortex, liver and pancreas using Anti-CEL antibody HPA008023 (A) shows similar protein distribution across tissues to independent antibody HPA052701 (B).
Immunohistochemical staining of human pancreas shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
Immunohistochemical staining of human cerebral cortex using Anti-CEL antibody HPA008023.
Immunohistochemical staining of human breast using Anti-CEL antibody HPA008023.
HPA008023
HPA008023
HPA008023