Anti-GM2A Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA008063
Artikelname: Anti-GM2A Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA008063
Hersteller Artikelnummer: HPA008063
Alternativnummer: ATA-HPA008063-100,ATA-HPA008063-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: SAP-3
GM2 ganglioside activator
Anti-GM2A
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 2760
UniProt: P17900
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: EPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: GM2A
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human skin and skeletal muscle tissues using Anti-GM2A antibody. Corresponding GM2A RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skin shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Western blot analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-GM2A antibody. Corresponding GM2A RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
HPA008063
HPA008063
HPA008063