Anti-GM2A

Catalog Number: ATA-HPA008063
Article Name: Anti-GM2A
Biozol Catalog Number: ATA-HPA008063
Supplier Catalog Number: HPA008063
Alternative Catalog Number: ATA-HPA008063-100,ATA-HPA008063-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: SAP-3
GM2 ganglioside activator
Anti-GM2A
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 2760
UniProt: P17900
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: GM2A
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human skin and skeletal muscle tissues using Anti-GM2A antibody. Corresponding GM2A RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skin shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Western blot analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-GM2A antibody. Corresponding GM2A RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
HPA008063-100ul
HPA008063-100ul
HPA008063-100ul