Anti-MUC5B

Artikelnummer: ATA-HPA008246
Artikelname: Anti-MUC5B
Artikelnummer: ATA-HPA008246
Hersteller Artikelnummer: HPA008246
Alternativnummer: ATA-HPA008246-100,ATA-HPA008246-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: MG1, MUC5
mucin 5B, oligomeric mucus/gel-forming
Anti-MUC5B
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 727897
UniProt: Q9HC84
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: CTCTYEDRTYSYQDVIYNTTDGLGACLIAICGSNGTIIRKAVACPGTPATTPFTFTTAWVPHSTTSPALPVSTVCVREVCRWSSWYNGHRPEPGLGGGDFETFENLRQRGYQVCPVLA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MUC5B
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000
Immunofluorescent staining of human cell line A549 shows localization to vesicles.
Immunohistochemistry analysis in human colon and skeletal muscle tissues using HPA008246 antibody. Corresponding MUC5B RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
HPA008246-100ul
HPA008246-100ul
HPA008246-100ul