Anti-MUC5B

Catalog Number: ATA-HPA008246
Article Name: Anti-MUC5B
Biozol Catalog Number: ATA-HPA008246
Supplier Catalog Number: HPA008246
Alternative Catalog Number: ATA-HPA008246-100,ATA-HPA008246-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MG1, MUC5
mucin 5B, oligomeric mucus/gel-forming
Anti-MUC5B
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 727897
UniProt: Q9HC84
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: CTCTYEDRTYSYQDVIYNTTDGLGACLIAICGSNGTIIRKAVACPGTPATTPFTFTTAWVPHSTTSPALPVSTVCVREVCRWSSWYNGHRPEPGLGGGDFETFENLRQRGYQVCPVLA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: MUC5B
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000
Immunofluorescent staining of human cell line A549 shows localization to vesicles.
Immunohistochemistry analysis in human colon and skeletal muscle tissues using HPA008246 antibody. Corresponding MUC5B RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
HPA008246-100ul
HPA008246-100ul
HPA008246-100ul