Anti-QPCT Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA008406
Artikelname: Anti-QPCT Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA008406
Hersteller Artikelnummer: HPA008406
Alternativnummer: ATA-HPA008406-100,ATA-HPA008406-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: GCT, QC
glutaminyl-peptide cyclotransferase
Anti-QPCT
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 25797
UniProt: Q16769
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDH
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: QPCT
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human adrenal gland and liver tissues using Anti-QPCT antibody. Corresponding QPCT RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human liver shows low expression as expected.
Immunohistochemical staining of human adrenal gland shows high expression.
Western blot analysis in human cell line SK-MEL-30.
Western blot analysis in control (vector only transfected HEK293T lysate) and QPCT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY415772).
HPA008406
HPA008406
HPA008406