Anti-QPCT Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA008406
Article Name: Anti-QPCT Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA008406
Supplier Catalog Number: HPA008406
Alternative Catalog Number: ATA-HPA008406-100,ATA-HPA008406-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GCT, QC
glutaminyl-peptide cyclotransferase
Anti-QPCT
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 25797
UniProt: Q16769
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDH
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: QPCT
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human adrenal gland and liver tissues using Anti-QPCT antibody. Corresponding QPCT RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human liver shows low expression as expected.
Immunohistochemical staining of human adrenal gland shows high expression.
Western blot analysis in human cell line SK-MEL-30.
Western blot analysis in control (vector only transfected HEK293T lysate) and QPCT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY415772).
HPA008406
HPA008406
HPA008406