Anti-HJURP Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA008436
Artikelname: Anti-HJURP Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA008436
Hersteller Artikelnummer: HPA008436
Alternativnummer: ATA-HPA008436-100,ATA-HPA008436-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DKFZp762E1312, FAKTS, hFLEG1, URLC9
Holliday junction recognition protein
Anti-HJURP
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 55355
UniProt: Q8NCD3
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: TPVVQMATLTYETPQGLRIWGGRLIKERNEGEIQDSSMKPADRTDGSVQAAAWGPELPSHRTVLGADSKSGEVDATSDQEESVAWALAPAVPQSPLKNELRRKYLTQVDILLQGAEYFECAGNRAGRDVRV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: HJURP
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line A-431 shows positivity in nucleus & nucleoli.
Immunohistochemical staining of human stomach shows moderate nuclear positivity in lymphoid cells.
Immunohistochemical staining of human lymph node shows moderate to strong nuclear positivity in lymphoid cells.
Immunohistochemical staining of human skin shows moderate nuclear positivity in a subset of basal cells in squamous epithelium.
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in some spermatogonia cells.
HPA008436
HPA008436
HPA008436