Anti-HJURP Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA008436
Article Name: Anti-HJURP Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA008436
Supplier Catalog Number: HPA008436
Alternative Catalog Number: ATA-HPA008436-100,ATA-HPA008436-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DKFZp762E1312, FAKTS, hFLEG1, URLC9
Holliday junction recognition protein
Anti-HJURP
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 55355
UniProt: Q8NCD3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TPVVQMATLTYETPQGLRIWGGRLIKERNEGEIQDSSMKPADRTDGSVQAAAWGPELPSHRTVLGADSKSGEVDATSDQEESVAWALAPAVPQSPLKNELRRKYLTQVDILLQGAEYFECAGNRAGRDVRV
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: HJURP
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line A-431 shows positivity in nucleus & nucleoli.
Immunohistochemical staining of human stomach shows moderate nuclear positivity in lymphoid cells.
Immunohistochemical staining of human lymph node shows moderate to strong nuclear positivity in lymphoid cells.
Immunohistochemical staining of human skin shows moderate nuclear positivity in a subset of basal cells in squamous epithelium.
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in some spermatogonia cells.
HPA008436
HPA008436
HPA008436