Anti-SLC22A2
Artikelnummer:
ATA-HPA008567
- Bilder (8)
| Artikelname: | Anti-SLC22A2 |
| Artikelnummer: | ATA-HPA008567 |
| Hersteller Artikelnummer: | HPA008567 |
| Alternativnummer: | ATA-HPA008567-100,ATA-HPA008567-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | OCT2 |
| solute carrier family 22 (organic cation transporter), member 2 |
| Anti-SLC22A2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6582 |
| UniProt: | O15244 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SLC22A2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human kidney and liver tissues using HPA008567 antibody. Corresponding SLC22A2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human endometrium shows no positivity in glandular cells as expected. |
|
|
Immunohistochemical staining of human testis shows no positivity in cells in seminiferous ducts as expected. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic/membranous positivity in cells in tubules. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
HPA008567-100ul |
|
|
HPA008567-100ul |
|
|
HPA008567-100ul |
Produktgarantie und fachkundiger Support
