Anti-SLC22A2
Catalog Number:
ATA-HPA008567
- Images (8)
| Article Name: | Anti-SLC22A2 |
| Biozol Catalog Number: | ATA-HPA008567 |
| Supplier Catalog Number: | HPA008567 |
| Alternative Catalog Number: | ATA-HPA008567-100,ATA-HPA008567-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | OCT2 |
| solute carrier family 22 (organic cation transporter), member 2 |
| Anti-SLC22A2 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 6582 |
| UniProt: | O15244 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SLC22A2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human kidney and liver tissues using HPA008567 antibody. Corresponding SLC22A2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human endometrium shows no positivity in glandular cells as expected. |
|
|
Immunohistochemical staining of human testis shows no positivity in cells in seminiferous ducts as expected. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic/membranous positivity in cells in tubules. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
HPA008567-100ul |
|
|
HPA008567-100ul |
|
|
HPA008567-100ul |
Product Guarantee and Expert Support
