Anti-IGDCC4 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA008576
Artikelname: Anti-IGDCC4 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA008576
Hersteller Artikelnummer: HPA008576
Alternativnummer: ATA-HPA008576-100,ATA-HPA008576-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: LOC57722, NOPE
immunoglobulin superfamily, DCC subclass, member 4
Anti-IGDCC4
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 57722
UniProt: Q8TDY8
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VEDRAEVHSLMGGGVSEGRSHSKRKISWAQPSGLSWAGSWAGCELPQAGPRPALTRALLPPAGTGQTLLLQALVYDAIKGNGRKKSPPACRNQVEAEVIVHSDFSASNGNPDLHLQDLEPEDPLPPEAPDLISGVGD
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: IGDCC4
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & cytosol.
Immunohistochemical staining of human placenta shows cytoplasmic positivity in trophoblastic cells.
Immunohistochemical staining of human cerebral cortex shows positivity in neuronal cells.
Immunohistochemical staining of human epididymis shows cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human kidney shows cytoplasmic positivity in cells in tubules.
HPA008576
HPA008576
HPA008576