Anti-IGDCC4

Catalog Number: ATA-HPA008576
Article Name: Anti-IGDCC4
Biozol Catalog Number: ATA-HPA008576
Supplier Catalog Number: HPA008576
Alternative Catalog Number: ATA-HPA008576-100,ATA-HPA008576-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: LOC57722, NOPE
immunoglobulin superfamily, DCC subclass, member 4
Anti-IGDCC4
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 57722
UniProt: Q8TDY8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VEDRAEVHSLMGGGVSEGRSHSKRKISWAQPSGLSWAGSWAGCELPQAGPRPALTRALLPPAGTGQTLLLQALVYDAIKGNGRKKSPPACRNQVEAEVIVHSDFSASNGNPDLHLQDLEPEDPLPPEAPDLISGVGD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: IGDCC4
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & cytosol.
Immunohistochemical staining of human placenta shows cytoplasmic positivity in trophoblastic cells.
Immunohistochemical staining of human cerebral cortex shows positivity in neuronal cells.
Immunohistochemical staining of human epididymis shows cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human kidney shows cytoplasmic positivity in cells in tubules.
HPA008576-100ul
HPA008576-100ul
HPA008576-100ul