Anti-CPA3 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA008689
- Bilder (9)
| Artikelname: | Anti-CPA3 Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA008689 |
| Hersteller Artikelnummer: | HPA008689 |
| Alternativnummer: | ATA-HPA008689-100,ATA-HPA008689-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CPA3 |
| carboxypeptidase A3 (mast cell) |
| Anti-CPA3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 1359 |
| UniProt: | P15088 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KNQNSKCIGTDLNRNFNASWNSIPNTNDPCADNYRGSAPESEKETKAVTNFIRSHLNEIKVYITFHSYSQMLLFPYGYTSKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGPIESTIYPISGSSL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CPA3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human cervix, uterine and skeletal muscle tissues using HPA008689 antibody. Corresponding CPA3 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cervix, uterine, skeletal muscle, skin and small intestine using Anti-CPA3 antibody HPA008689 (A) shows similar protein distribution across tissues to independent antibody HPA006479 (B). |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
Immunohistochemical staining of human cervix, uterine shows strong cytoplasmic positivity in mast cells. |
|
|
Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in mast cells. |
|
|
Immunohistochemical staining of human skin shows strong cytoplasmic positivity in mast cells. |
|
|
HPA008689 |
|
|
HPA008689 |
|
|
HPA008689 |
Produktgarantie und fachkundiger Support
