Anti-CPA3

Catalog Number: ATA-HPA008689
Article Name: Anti-CPA3
Biozol Catalog Number: ATA-HPA008689
Supplier Catalog Number: HPA008689
Alternative Catalog Number: ATA-HPA008689-100,ATA-HPA008689-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CPA3
carboxypeptidase A3 (mast cell)
Anti-CPA3
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 1359
UniProt: P15088
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KNQNSKCIGTDLNRNFNASWNSIPNTNDPCADNYRGSAPESEKETKAVTNFIRSHLNEIKVYITFHSYSQMLLFPYGYTSKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGPIESTIYPISGSSL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CPA3
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human cervix, uterine and skeletal muscle tissues using HPA008689 antibody. Corresponding CPA3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cervix, uterine, skeletal muscle, skin and small intestine using Anti-CPA3 antibody HPA008689 (A) shows similar protein distribution across tissues to independent antibody HPA006479 (B).
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemical staining of human cervix, uterine shows strong cytoplasmic positivity in mast cells.
Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in mast cells.
Immunohistochemical staining of human skin shows strong cytoplasmic positivity in mast cells.
HPA008689-100ul
HPA008689-100ul
HPA008689-100ul