Anti-CPA3

Product Overview

• Article Name: Anti-CPA3
• Biozol Catalog Number: ATA-HPA008689
• Supplier Catalog Number: HPA008689
• Alternative Catalog Number: ATA-HPA008689-100,ATA-HPA008689-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Sonstiges
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CPA3

Product Description

carboxypeptidase A3 (mast cell)

Additional Information

Anti-CPA3

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 1359
• UniProt: P15088
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: KNQNSKCIGTDLNRNFNASWNSIPNTNDPCADNYRGSAPESEKETKAVTNFIRSHLNEIKVYITFHSYSQMLLFPYGYTSKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGPIESTIYPISGSSL
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CPA3
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:200 - 1:500

Images

Immunohistochemistry analysis in human cervix, uterine and skeletal muscle tissues using HPA008689 antibody. Corresponding CPA3 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human cervix, uterine, skeletal muscle, skin and small intestine using Anti-CPA3 antibody HPA008689 (A) shows similar protein distribution across tissues to independent antibody HPA006479 (B).

Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemical staining of human cervix, uterine shows strong cytoplasmic positivity in mast cells.

Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in mast cells.

Immunohistochemical staining of human skin shows strong cytoplasmic positivity in mast cells.

HPA008689-100ul

HPA008689-100ul

HPA008689-100ul