Anti-PITX1

Artikelnummer: ATA-HPA008743
Artikelname: Anti-PITX1
Artikelnummer: ATA-HPA008743
Hersteller Artikelnummer: HPA008743
Alternativnummer: ATA-HPA008743-100,ATA-HPA008743-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ChIP, ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: BFT, POTX, PTX1
paired-like homeodomain 1
Anti-PITX1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 5307
UniProt: P78337
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PITX1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli.
Immunohistochemical staining of human esophagus shows moderate to strong nuclear positivity in squamous epithelial cells.
Immunohistochemical staining of human skin shows moderate to strong nuclear positivity in squamous epithelial cells.
Immunohistochemical staining of human stomach shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemical staining of human tonsil shows weak to moderate nuclear positivity in germinal center cells.
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
HPA008743-100ul
HPA008743-100ul