Anti-PITX1
Catalog Number:
ATA-HPA008743
- Images (9)
| Article Name: | Anti-PITX1 |
| Biozol Catalog Number: | ATA-HPA008743 |
| Supplier Catalog Number: | HPA008743 |
| Alternative Catalog Number: | ATA-HPA008743-100,ATA-HPA008743-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ChIP, ICC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BFT, POTX, PTX1 |
| paired-like homeodomain 1 |
| Anti-PITX1 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 5307 |
| UniProt: | P78337 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PITX1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli. |
|
|
Immunohistochemical staining of human esophagus shows moderate to strong nuclear positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human skin shows moderate to strong nuclear positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human stomach shows moderate to strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human tonsil shows weak to moderate nuclear positivity in germinal center cells. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
|
|
|
HPA008743-100ul |
|
|
HPA008743-100ul |
Product Guarantee and Expert Support
