Anti-TBX5
Artikelnummer:
ATA-HPA008786
- Bilder (7)
| Artikelname: | Anti-TBX5 |
| Artikelnummer: | ATA-HPA008786 |
| Hersteller Artikelnummer: | HPA008786 |
| Alternativnummer: | ATA-HPA008786-100,ATA-HPA008786-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HOS |
| T-box 5 |
| Anti-TBX5 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6910 |
| UniProt: | Q99593 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MSRMQSKEYPVVPRSTVRQKVASNHSPFSSESRALSTSSNLGSQYQCENGVSGPSQDLLPPPNPYPLPQEHSQIYHCTKRKEEECSTTDHPYKKPYMETSPSEEDSFYRSSYPQQQG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TBX5 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human heart muscle shows strong nuclear positivity in cardiomyocytes. |
|
|
Immunohistochemical staining of human lung shows moderate nuclear positivity in a subset of pneumocytes. |
|
|
Immunohistochemical staining of human placenta shows moderate nuclear positivity in Hofbauer cells, as well as weaker positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
HPA008786-100ul |
|
|
HPA008786-100ul |
|
|
HPA008786-100ul |
Produktgarantie und fachkundiger Support
