Anti-TBX5
Catalog Number:
ATA-HPA008786
- Images (7)
| Article Name: | Anti-TBX5 |
| Biozol Catalog Number: | ATA-HPA008786 |
| Supplier Catalog Number: | HPA008786 |
| Alternative Catalog Number: | ATA-HPA008786-100,ATA-HPA008786-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HOS |
| T-box 5 |
| Anti-TBX5 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 6910 |
| UniProt: | Q99593 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MSRMQSKEYPVVPRSTVRQKVASNHSPFSSESRALSTSSNLGSQYQCENGVSGPSQDLLPPPNPYPLPQEHSQIYHCTKRKEEECSTTDHPYKKPYMETSPSEEDSFYRSSYPQQQG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TBX5 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human heart muscle shows strong nuclear positivity in cardiomyocytes. |
|
|
Immunohistochemical staining of human lung shows moderate nuclear positivity in a subset of pneumocytes. |
|
|
Immunohistochemical staining of human placenta shows moderate nuclear positivity in Hofbauer cells, as well as weaker positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
HPA008786-100ul |
|
|
HPA008786-100ul |
|
|
HPA008786-100ul |
Product Guarantee and Expert Support
