Anti-FDFT1

Artikelnummer: ATA-HPA008874
Artikelname: Anti-FDFT1
Artikelnummer: ATA-HPA008874
Hersteller Artikelnummer: HPA008874
Alternativnummer: ATA-HPA008874-100,ATA-HPA008874-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FDFT1
farnesyl-diphosphate farnesyltransferase 1
Anti-FDFT1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 2222
UniProt: P37268
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: FDFT1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.
Western blot analysis in human cell line HEK 293.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA008874-100ul
HPA008874-100ul
HPA008874-100ul