Anti-FDFT1

Catalog Number: ATA-HPA008874
Article Name: Anti-FDFT1
Biozol Catalog Number: ATA-HPA008874
Supplier Catalog Number: HPA008874
Alternative Catalog Number: ATA-HPA008874-100,ATA-HPA008874-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FDFT1
farnesyl-diphosphate farnesyltransferase 1
Anti-FDFT1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 2222
UniProt: P37268
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICR
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: FDFT1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.
Western blot analysis in human cell line HEK 293.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA008874-100ul
HPA008874-100ul
HPA008874-100ul