Anti-COL12A1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA009143
Artikelname: Anti-COL12A1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA009143
Hersteller Artikelnummer: HPA009143
Alternativnummer: ATA-HPA009143-100,ATA-HPA009143-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: COL12A1L
collagen, type XII, alpha 1
Anti-COL12A1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 1303
UniProt: Q99715
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VTTPPNQRRRTLENLIPDTKYEVSVIPEYFSGPGTPLTGNAATEEVRGNPRDLRVSDPTTSTMKLSWSGAPGKVKQYLVTYTPVAGGETQEVTVRGDTTNTVLQGLKEGTQYALSVTALYASGAG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: COL12A1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.
Immunohistochemical staining of human endometrium shows strong positivity in basement membranes.
Immunohistochemical staining of human liver shows very weak cytoplasmic positivity in hepatocytes.
Immunohistochemical staining of human testis shows strong membranous positivity in peritubular myoid cells.
Western blot analysis in human cell lines U2OS and A-431 using Anti-COL12A1 antibody. Corresponding COL12A1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
HPA009143
HPA009143
HPA009143