Anti-COL12A1

Catalog Number: ATA-HPA009143
Article Name: Anti-COL12A1
Biozol Catalog Number: ATA-HPA009143
Supplier Catalog Number: HPA009143
Alternative Catalog Number: ATA-HPA009143-100,ATA-HPA009143-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: COL12A1L
collagen, type XII, alpha 1
Anti-COL12A1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 1303
UniProt: Q99715
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VTTPPNQRRRTLENLIPDTKYEVSVIPEYFSGPGTPLTGNAATEEVRGNPRDLRVSDPTTSTMKLSWSGAPGKVKQYLVTYTPVAGGETQEVTVRGDTTNTVLQGLKEGTQYALSVTALYASGAG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: COL12A1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.
Immunohistochemical staining of human endometrium shows strong positivity in basement membranes.
Immunohistochemical staining of human liver shows very weak cytoplasmic positivity in hepatocytes.
Immunohistochemical staining of human testis shows strong membranous positivity in peritubular myoid cells.
Western blot analysis in human cell lines U2OS and A-431 using Anti-COL12A1 antibody. Corresponding COL12A1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
HPA009143-100ul
HPA009143-100ul
HPA009143-100ul