Anti-PIP Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA009177
Artikelname: Anti-PIP Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA009177
Hersteller Artikelnummer: HPA009177
Alternativnummer: ATA-HPA009177-100,ATA-HPA009177-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: GCDFP-15, GCDFP15, GPIP4
prolactin-induced protein
Anti-PIP
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 5304
UniProt: P12273
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: FDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PIP
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human salivary gland and skeletal muscle tissues using HPA009177 antibody. Corresponding PIP RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human salivary gland shows strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human breast shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
HPA009177
HPA009177
HPA009177