Anti-PIP

Catalog Number: ATA-HPA009177
Article Name: Anti-PIP
Biozol Catalog Number: ATA-HPA009177
Supplier Catalog Number: HPA009177
Alternative Catalog Number: ATA-HPA009177-100,ATA-HPA009177-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GCDFP-15, GCDFP15, GPIP4
prolactin-induced protein
Anti-PIP
Clonality: Polyclonal
Isotype: IgG
NCBI: 5304
UniProt: P12273
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PIP
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human salivary gland and skeletal muscle tissues using HPA009177 antibody. Corresponding PIP RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human salivary gland shows strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human breast shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
HPA009177-100ul
HPA009177-100ul
HPA009177-100ul