Anti-CANX
Artikelnummer:
ATA-HPA009433
- Bilder (10)
| Artikelname: | Anti-CANX |
| Artikelnummer: | ATA-HPA009433 |
| Hersteller Artikelnummer: | HPA009433 |
| Alternativnummer: | ATA-HPA009433-100,ATA-HPA009433-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CNX, IP90, P90 |
| calnexin |
| Anti-CANX |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 821 |
| UniProt: | P27824 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEI |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CANX |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum. |
|
|
Immunohistochemical staining of human cerebral cortex, liver, placenta and thyroid gland using Anti-CANX antibody HPA009433 (A) shows similar protein distribution across tissues to independent antibody HPA009696 (B). |
|
|
Immunohistochemical staining of human placenta using Anti-CANX antibody HPA009433. |
|
|
Immunohistochemical staining of human thyroid gland using Anti-CANX antibody HPA009433. |
|
|
Immunohistochemical staining of human liver using Anti-CANX antibody HPA009433. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-CANX antibody HPA009433. |
|
|
HPA009433-100ul |
|
|
|
|
|
HPA009433-100ul |
|
|
HPA009433-100ul |
Produktgarantie und fachkundiger Support
