Anti-CANX
Catalog Number:
ATA-HPA009433
- Images (10)
| Article Name: | Anti-CANX |
| Biozol Catalog Number: | ATA-HPA009433 |
| Supplier Catalog Number: | HPA009433 |
| Alternative Catalog Number: | ATA-HPA009433-100,ATA-HPA009433-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CNX, IP90, P90 |
| calnexin |
| Anti-CANX |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 821 |
| UniProt: | P27824 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEI |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CANX |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum. |
|
|
Immunohistochemical staining of human cerebral cortex, liver, placenta and thyroid gland using Anti-CANX antibody HPA009433 (A) shows similar protein distribution across tissues to independent antibody HPA009696 (B). |
|
|
Immunohistochemical staining of human placenta using Anti-CANX antibody HPA009433. |
|
|
Immunohistochemical staining of human thyroid gland using Anti-CANX antibody HPA009433. |
|
|
Immunohistochemical staining of human liver using Anti-CANX antibody HPA009433. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-CANX antibody HPA009433. |
|
|
HPA009433-100ul |
|
|
|
|
|
HPA009433-100ul |
|
|
HPA009433-100ul |
Product Guarantee and Expert Support
