Anti-NDFIP1

Artikelnummer: ATA-HPA009682
Artikelname: Anti-NDFIP1
Artikelnummer: ATA-HPA009682
Hersteller Artikelnummer: HPA009682
Alternativnummer: ATA-HPA009682-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: MGC10924, N4WBP5
Nedd4 family interacting protein 1
Anti-NDFIP1
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 80762
UniProt: Q9BT67
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESGFPKP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: NDFIP1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.
Immunohistochemical staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons.
Immunohistochemical staining of human kidney shows strong granular positivity in cytoplasm in cells in tubules.
Immunohistochemical staining of human testis shows moderate granular cytoplasmic positivity in Leydig cells.
Western blot analysis in human cell line RPMI-8226.
HPA009682-100ul
HPA009682-100ul
HPA009682-100ul