Anti-NDFIP1 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA009682
Article Name: Anti-NDFIP1 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA009682
Supplier Catalog Number: HPA009682
Alternative Catalog Number: ATA-HPA009682-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MGC10924, N4WBP5
Nedd4 family interacting protein 1
Anti-NDFIP1
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 80762
UniProt: Q9BT67
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESGFPKP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: NDFIP1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.
Immunohistochemical staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons.
Immunohistochemical staining of human kidney shows strong granular positivity in cytoplasm in cells in tubules.
Immunohistochemical staining of human testis shows moderate granular cytoplasmic positivity in Leydig cells.
Western blot analysis in human cell line RPMI-8226.
HPA009682
HPA009682
HPA009682