Anti-ANGPTL1
Artikelnummer:
ATA-HPA009976
- Bilder (8)
| Artikelname: | Anti-ANGPTL1 |
| Artikelnummer: | ATA-HPA009976 |
| Hersteller Artikelnummer: | HPA009976 |
| Alternativnummer: | ATA-HPA009976-100,ATA-HPA009976-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ANG3, ANGPT3, AngY, ARP1 |
| angiopoietin-like 1 |
| Anti-ANGPTL1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9068 |
| UniProt: | O95841 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LKMATRYRELEVKYASLTDLVNNQSVMITLLEEQCLRIFSRQDTHVSPPLVQVVPQHIPNSQQYTPGLLGGNEIQRDPGYPRDLMPPPDLATSPTKSPFKIPPVTFINEGPFKDCQQAKEAGHSVSGIYMIKPENSNGPMQLWCENS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ANGPTL1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human lymph node shows no positivity in non - germinal center cells as expected. |
|
|
HPA009976-100ul |
|
|
HPA009976-100ul |
|
|
HPA009976-100ul |
Produktgarantie und fachkundiger Support
