Anti-ANGPTL1
Catalog Number:
ATA-HPA009976
- Images (8)
| Article Name: | Anti-ANGPTL1 |
| Biozol Catalog Number: | ATA-HPA009976 |
| Supplier Catalog Number: | HPA009976 |
| Alternative Catalog Number: | ATA-HPA009976-100,ATA-HPA009976-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ANG3, ANGPT3, AngY, ARP1 |
| angiopoietin-like 1 |
| Anti-ANGPTL1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 9068 |
| UniProt: | O95841 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LKMATRYRELEVKYASLTDLVNNQSVMITLLEEQCLRIFSRQDTHVSPPLVQVVPQHIPNSQQYTPGLLGGNEIQRDPGYPRDLMPPPDLATSPTKSPFKIPPVTFINEGPFKDCQQAKEAGHSVSGIYMIKPENSNGPMQLWCENS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ANGPTL1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human lymph node shows no positivity in non - germinal center cells as expected. |
|
|
HPA009976-100ul |
|
|
HPA009976-100ul |
|
|
HPA009976-100ul |
Product Guarantee and Expert Support
