Anti-MTM1

Artikelnummer: ATA-HPA010008
Artikelname: Anti-MTM1
Artikelnummer: ATA-HPA010008
Hersteller Artikelnummer: HPA010008
Alternativnummer: ATA-HPA010008-100,ATA-HPA010008-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: MTM1
myotubularin 1
Anti-MTM1
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 4534
UniProt: Q13496
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KFNVDGWTVYNPVEEYRRQGLPNHHWRITFINKCYELCDTYPALLVVPYRASDDDLRRVATFRSRNRIPVLSWIHPENKTVIVRCSQPLVGMSGKRNKDDEKYLDVIRETNKQISKLTIYDARPSVNAVANK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MTM1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000
Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane.
Immunohistochemical staining of human testis shows moderate to strong cytoplasmic positivity in subsets of cells in seminiferous ducts.
Immunohistochemical staining of human fallopian tube shows moderate to strong membranous positivity in subsets of glandular cells.
Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
Immunohistochemical staining of human small intestine shows moderate to strong membranous positivity in glandular cells.
HPA010008-100ul
HPA010008-100ul
HPA010008-100ul